PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aqcoe1G138800.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Ranunculales; Ranunculaceae; Thalictroideae; Aquilegia
Family TALE
Protein Properties Length: 789aa    MW: 86780.7 Da    PI: 7.2409
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aqcoe1G138800.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.33e-096026391954
                        HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
           Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                        Fe   ++yp+ +++  LA+++gL+ +qV++WF N R +
  Aqcoe1G138800.1.p 602 FEHflHPYPTDTDKHMLASQTGLSRNQVSNWFINARVR 639
                        554459******************************87 PP

2BELL103.31.8e-33464533372
               BELL   3 qelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                         e q+kkakLl ++eeV+krY+qy++q+q+v+ssFe v+gl sa+pYtslAlk++Sr+F  Lk+ai+ q+
  Aqcoe1G138800.1.p 464 PEFQQKKAKLLYMQEEVCKRYRQYHQQMQMVVSSFESVVGLSSATPYTSLALKTVSRNFCFLKNAISVQL 533
                        589***************************************************************9996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005741.1E-44371531IPR006563POX domain
PfamPF075262.3E-41376530IPR006563POX domain
PROSITE profilePS5007111.855580643IPR001356Homeobox domain
CDDcd000861.48E-11583644No hitNo description
SMARTSM003897.8E-9583647IPR001356Homeobox domain
SuperFamilySSF466897.7E-17585651IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.605.6E-28586649IPR009057Homeodomain-like
PfamPF059203.5E-18600639IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010076Biological Processmaintenance of floral meristem identity
GO:0010077Biological Processmaintenance of inflorescence meristem identity
GO:0010223Biological Processsecondary shoot formation
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0010229Biological Processinflorescence development
GO:0048645Biological Processorgan formation
GO:0080006Biological Processinternode patterning
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 789 aa     Download sequence    Send to blast
MSEKFESGYL NNQTTSYHNS AAEEINIFRT DSHVAQQRRR DKLRNVSQSS ASAAHHLLQL  60
PSDSRVNPDY NDTAMFSSEM LNFSMNRHHP IFAHNRDGVT VALANQSDRP LALDHGVGFS  120
NSSHAVSSSL VPFGSVDGSQ NSYWKGIDGS QQSCDWVVNG SSNQDLMVIG GSLSGNVKAI  180
NIASPSNYAK PGCNGYEDAN SGSASGRCGE LNFRSPVYRG ALQETDIPSN MVSQGCEMVS  240
LVQHNARSEA SNSSWPHPTY GNDMNALRIS ESRWNNIDTY VGDSTSRGLS LSLSSQPSPK  300
INVAHFGDKF GSEKSAVTCT GFQDSKANTS GCLYTDSNSP IANDGHGNSV HGIVSSSNYP  360
RRNIGPLGPF TGYATILNNS KFLKPAQQLL DDICCIAGSK KIKRGELSES VSREIGISSN  420
FLHAGNNRGR RGGDSAFSSS SFDSSNEAVG EGGLGSGSCQ TYRPEFQQKK AKLLYMQEEV  480
CKRYRQYHQQ MQMVVSSFES VVGLSSATPY TSLALKTVSR NFCFLKNAIS VQLRQISKAL  540
GEDLLSPSSG TSSRGDVDIP RFRCNDRNLT KQNASFEHQQ PIWRPQRGLP ERAVSVLRAW  600
LFEHFLHPYP TDTDKHMLAS QTGLSRNQVS NWFINARVRV WKPMVEEMHM LESNGCAETE  660
LNSSESNQKP DPNIIGQMSN QSSNKLQIDH VSDNQQQYTS GDAMHAEDGG HTEDAGIFEQ  720
WSREKRSRME CQTTGVDGDL IGFHPYHRGL GAVSLTLGLR HSTDQQQHQR EHQLRRHYGS  780
QMIHDFVG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4xrs_A1e-16589646158Homeobox protein Meis1
4xrs_B1e-16589646158Homeobox protein Meis1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002282519.20.0PREDICTED: BEL1-like homeodomain protein 9
RefseqXP_010651200.10.0PREDICTED: BEL1-like homeodomain protein 9
RefseqXP_010651201.10.0PREDICTED: BEL1-like homeodomain protein 9
RefseqXP_010651202.10.0PREDICTED: BEL1-like homeodomain protein 9
RefseqXP_010651203.10.0PREDICTED: BEL1-like homeodomain protein 9
RefseqXP_010651204.10.0PREDICTED: BEL1-like homeodomain protein 9
TrEMBLA5AWN30.0A5AWN3_VITVI; Putative uncharacterized protein
STRINGVIT_06s0004g02580.t010.0(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G27990.12e-90BEL1-like homeodomain 8